(data stored in ACNUC7421 zone)

EMBL: AP009493.PE253

AP009493.PE253       Location/Qualifiers
FT   CDS             272567..272848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_253"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17082"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNQ9"
FT                   /protein_id="BAG17082.1"
FT                   /translation="MQARRRRRTDGRRFAGVAAERERALVRLTVCSSSRDPVWPVQMGP
FT                   GRLDRMSLRGAALRAVRVFMRVVHGKCPENQRCYSLVTCGSVGLRVTQ"
     MQARRRRRTD GRRFAGVAAE RERALVRLTV CSSSRDPVWP VQMGPGRLDR MSLRGAALRA        60
     VRVFMRVVHG KCPENQRCYS LVTCGSVGLR VTQ                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page