(data stored in ACNUC7421 zone)

EMBL: AP009493.PE255

AP009493.PE255       Location/Qualifiers
FT   CDS             273647..274192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_255"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17084"
FT                   /db_xref="GOA:B1VNR1"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR1"
FT                   /protein_id="BAG17084.1"
FT                   /translation="MGGRVTAVSRNERYGFSKPTRPSITLLAGLGVEGDVHAGTTIRHQ
FT                   FRMTYEPDLPNLRQVHLMHEELFEELALKGFDVSAGRLGENVTTAGVDLLGLPAGTLLH
FT                   LGKEAVLEVTGLRNPCAKINDFRPGLLGEVFALDPVSGEFTFKSGVMAVVRTGGTVRAG
FT                   DTVEVELPPPPHRALERV"
     MGGRVTAVSR NERYGFSKPT RPSITLLAGL GVEGDVHAGT TIRHQFRMTY EPDLPNLRQV        60
     HLMHEELFEE LALKGFDVSA GRLGENVTTA GVDLLGLPAG TLLHLGKEAV LEVTGLRNPC       120
     AKINDFRPGL LGEVFALDPV SGEFTFKSGV MAVVRTGGTV RAGDTVEVEL PPPPHRALER       180
     V                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page