(data stored in ACNUC7421 zone)

EMBL: AP009493.PE258

AP009493.PE258       Location/Qualifiers
FT   CDS             complement(275486..276595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_258"
FT                   /product="putative amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_258"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17087"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR4"
FT                   /protein_id="BAG17087.1"
FT                   /translation="MNTPPSPSGAEHTDRSPVRLGALVPLTRPGWVEAGRHLLAGLDLA
FT                   VGEVNDAGGIDGRPLELVVRDTAADPERAAAAVDELAHLGVAAVAGEYHSVVARAAAAR
FT                   ADALGVPFLCSSAVLDALTEEPTEWVARLAPAQSHGWRIYADFLLRTGRSRIAVVTQPS
FT                   VYWASGTRVLRDHLAARGGTVLELDATLTPEALCDALVDHGATALLLLVGHPEPAVPIV
FT                   RAVRGDRRLAEILLGAPAGQPEFAEWAAALGDDGAGIPFLRYLPERLGPLGERVGKELR
FT                   ERLGEAPSFVAFEGWDTVAVLAGLLRSHGTDRAALAGSWPRVAVEGTRGPIRFSRTPGI
FT                   SVWQWAWTPIHVVDRDPAEPDRFRILHAG"
     MNTPPSPSGA EHTDRSPVRL GALVPLTRPG WVEAGRHLLA GLDLAVGEVN DAGGIDGRPL        60
     ELVVRDTAAD PERAAAAVDE LAHLGVAAVA GEYHSVVARA AAARADALGV PFLCSSAVLD       120
     ALTEEPTEWV ARLAPAQSHG WRIYADFLLR TGRSRIAVVT QPSVYWASGT RVLRDHLAAR       180
     GGTVLELDAT LTPEALCDAL VDHGATALLL LVGHPEPAVP IVRAVRGDRR LAEILLGAPA       240
     GQPEFAEWAA ALGDDGAGIP FLRYLPERLG PLGERVGKEL RERLGEAPSF VAFEGWDTVA       300
     VLAGLLRSHG TDRAALAGSW PRVAVEGTRG PIRFSRTPGI SVWQWAWTPI HVVDRDPAEP       360
     DRFRILHAG                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page