(data stored in ACNUC7421 zone)

EMBL: AP009493.PE260

AP009493.PE260       Location/Qualifiers
FT   CDS             278779..279135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17089"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR6"
FT                   /protein_id="BAG17089.1"
FT                   /translation="MRCREILAFCAGIAVLLLISVFTLGSSTQTPGTVDTSTHSHSVSV
FT                   FDGSGPSAPLEGVDGDATLQHRHKAGSATASPPVPAGIPSTSPDLHDCAADAARQHAAH
FT                   PGSRSPARVQILRC"
     MRCREILAFC AGIAVLLLIS VFTLGSSTQT PGTVDTSTHS HSVSVFDGSG PSAPLEGVDG        60
     DATLQHRHKA GSATASPPVP AGIPSTSPDL HDCAADAARQ HAAHPGSRSP ARVQILRC         118
//

If you have problems or comments...

PBIL Back to PBIL home page