(data stored in ACNUC7421 zone)

EMBL: AP009493.PE261

AP009493.PE261       Location/Qualifiers
FT   CDS             279468..280124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_261"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17090"
FT                   /db_xref="GOA:B1VNR7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR7"
FT                   /protein_id="BAG17090.1"
FT                   /translation="MQHFPLASEQASGIAGWATSLVETMGGPGAGLAIALENLFPPLPS
FT                   EIILPLTGFAAGQGVISLFSALFWTTLGSVVGAVALYQIGALFGRDRMYALWERLPLVK
FT                   VSDLRKTEAWFVKHGMKAIFFGRMIPIFRSLISVPAGLERMPLPIFILLTALGSFIWNF
FT                   ILVMAGYLLGDQWELVESYVGVLSKVVLVLVVVALVVAVARRLRSRRGDRQRGHA"
     MQHFPLASEQ ASGIAGWATS LVETMGGPGA GLAIALENLF PPLPSEIILP LTGFAAGQGV        60
     ISLFSALFWT TLGSVVGAVA LYQIGALFGR DRMYALWERL PLVKVSDLRK TEAWFVKHGM       120
     KAIFFGRMIP IFRSLISVPA GLERMPLPIF ILLTALGSFI WNFILVMAGY LLGDQWELVE       180
     SYVGVLSKVV LVLVVVALVV AVARRLRSRR GDRQRGHA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page