(data stored in ACNUC7421 zone)

EMBL: AP009493.PE265

AP009493.PE265       Location/Qualifiers
FT   CDS             complement(282684..283175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_265"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17094"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS1"
FT                   /protein_id="BAG17094.1"
FT                   /translation="MDPLTEQDIRTSFVNCTKGEAKRLSVPRDLLDRPWGDLDFLGWRD
FT                   PQAPDRAYLVLGSGEGPVGIQLRSSDAGSWQTRRSMCSLCVTVHTGGVSLLVAPRAGKA
FT                   GQQGNSVGAYMCTDLACSLYVRGKKDAGVGSRLRESLTLEQQIERTVMNVEAFIARVTG
FT                   "
     MDPLTEQDIR TSFVNCTKGE AKRLSVPRDL LDRPWGDLDF LGWRDPQAPD RAYLVLGSGE        60
     GPVGIQLRSS DAGSWQTRRS MCSLCVTVHT GGVSLLVAPR AGKAGQQGNS VGAYMCTDLA       120
     CSLYVRGKKD AGVGSRLRES LTLEQQIERT VMNVEAFIAR VTG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page