(data stored in ACNUC7421 zone)

EMBL: AP009493.PE267

AP009493.PE267       Location/Qualifiers
FT   CDS             283905..285089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_267"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17096"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS3"
FT                   /protein_id="BAG17096.1"
FT                   /translation="MTTRHDWTTTPISADIVRGALDLERTGRGTLPHRLPAGARRQIPD
FT                   DQLAMAASQPSGVRLAFRTRATAVELDVVATKRVYPGAPPRPDGVYELLVDGRPTARAS
FT                   APDGDTLTVDLASMTSRTRPGPVETLRFTGLPDEDKDVEIWLPHDETTLLVALRTDAPL
FT                   RSPAPSGRPVWLHHGSSISHGSNATTPTGTWPALAAGLGGADLINLGFSGSALLDPFTA
FT                   RAMRDTPADLISVKIGINLVNADLMRLRAFGPAVHGFLDTLREGHPTAPLLVVSPICCP
FT                   IHETTPGPCAPDRSAMGEGRLRFVAMGDPAETAAGKLTLTVIREQLARIVAERAADDPH
FT                   LHYLDGLDLYGASDHAELPLPDDLHPDPAAHRRIAERFARHAFGHDGPFTPKHR"
     MTTRHDWTTT PISADIVRGA LDLERTGRGT LPHRLPAGAR RQIPDDQLAM AASQPSGVRL        60
     AFRTRATAVE LDVVATKRVY PGAPPRPDGV YELLVDGRPT ARASAPDGDT LTVDLASMTS       120
     RTRPGPVETL RFTGLPDEDK DVEIWLPHDE TTLLVALRTD APLRSPAPSG RPVWLHHGSS       180
     ISHGSNATTP TGTWPALAAG LGGADLINLG FSGSALLDPF TARAMRDTPA DLISVKIGIN       240
     LVNADLMRLR AFGPAVHGFL DTLREGHPTA PLLVVSPICC PIHETTPGPC APDRSAMGEG       300
     RLRFVAMGDP AETAAGKLTL TVIREQLARI VAERAADDPH LHYLDGLDLY GASDHAELPL       360
     PDDLHPDPAA HRRIAERFAR HAFGHDGPFT PKHR                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page