(data stored in ACNUC7421 zone)

EMBL: AP009493.PE269

AP009493.PE269       Location/Qualifiers
FT   CDS             286065..286955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_269"
FT                   /product="putative Sir2-family regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_269"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17098"
FT                   /db_xref="GOA:B1VNS5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS5"
FT                   /protein_id="BAG17098.1"
FT                   /translation="MRMRPTLSWTSAEEPLPGTTDLEPVVEALRGGGVLVLSGAGISTE
FT                   SGIPDYRGEGGSLSRHTPMTYQDFTADAGARRRYWARSHLGWRTFGRARPNAGHRAVAA
FT                   FGRRGLLSGVITQNVDGLHQAAGSADVVDLHGRLDRVVCLSCGAFGPRSELARRLEEAN
FT                   EGFAPVAAAMNPDGDADLTDEQVGDFRVVPCAVCGGVLKPDVVFFGESVPPRRVEHCRA
FT                   LVDAASALLVLGSSLTVMSGLRFVRQAERSGLPVLIVNRDPTRGDRHALPRIALPLGDA
FT                   LTTAAGRLGVRVDDD"
     MRMRPTLSWT SAEEPLPGTT DLEPVVEALR GGGVLVLSGA GISTESGIPD YRGEGGSLSR        60
     HTPMTYQDFT ADAGARRRYW ARSHLGWRTF GRARPNAGHR AVAAFGRRGL LSGVITQNVD       120
     GLHQAAGSAD VVDLHGRLDR VVCLSCGAFG PRSELARRLE EANEGFAPVA AAMNPDGDAD       180
     LTDEQVGDFR VVPCAVCGGV LKPDVVFFGE SVPPRRVEHC RALVDAASAL LVLGSSLTVM       240
     SGLRFVRQAE RSGLPVLIVN RDPTRGDRHA LPRIALPLGD ALTTAAGRLG VRVDDD           296
//

If you have problems or comments...

PBIL Back to PBIL home page