(data stored in ACNUC7421 zone)

EMBL: AP009493.PE270

AP009493.PE270       Location/Qualifiers
FT   CDS             complement(286993..288015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_270"
FT                   /product="putative iron uptake ABC transporter iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17099"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS6"
FT                   /protein_id="BAG17099.1"
FT                   /translation="MPNPLRPAALAFAAALALTGCGADVTSQADGRTGESGADRHYPVT
FT                   VENCGEEKTYDKAPQRVVTNDTGITEIMFALGLEDHMAGYVMPDDKGDRTSVPWKDGYE
FT                   KTKWLSKERINKELVLDARADLVFAGWNYGFNEGEGFTPAELERVGIDSYLLSESCRNG
FT                   QGKARGVMPPLEALYTDLRNLGRIFDVEDRADTLITSFRQEVAEARAKAAEGDDRLRVF
FT                   LYDDGKDKPLTSGAYAGPHDIITKAGGDHIMKDLKDSWTTVGWETVVDRDPEVIVINNY
FT                   GDTGADEKRRFLKSYKPLAGVSAIRNDRIVVLDYVDLVESPRNPAAISSLAEDLREFAR
FT                   "
     MPNPLRPAAL AFAAALALTG CGADVTSQAD GRTGESGADR HYPVTVENCG EEKTYDKAPQ        60
     RVVTNDTGIT EIMFALGLED HMAGYVMPDD KGDRTSVPWK DGYEKTKWLS KERINKELVL       120
     DARADLVFAG WNYGFNEGEG FTPAELERVG IDSYLLSESC RNGQGKARGV MPPLEALYTD       180
     LRNLGRIFDV EDRADTLITS FRQEVAEARA KAAEGDDRLR VFLYDDGKDK PLTSGAYAGP       240
     HDIITKAGGD HIMKDLKDSW TTVGWETVVD RDPEVIVINN YGDTGADEKR RFLKSYKPLA       300
     GVSAIRNDRI VVLDYVDLVE SPRNPAAISS LAEDLREFAR                             340
//

If you have problems or comments...

PBIL Back to PBIL home page