(data stored in ACNUC7421 zone)

EMBL: AP009493.PE272

AP009493.PE272       Location/Qualifiers
FT   CDS             complement(288814..289923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_272"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_272"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17101"
FT                   /db_xref="GOA:B1VNS8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS8"
FT                   /protein_id="BAG17101.1"
FT                   /translation="MATSVDRIPSKPSRPAHDGTGPAPPRRVPLPILLACLCAALPLSL
FT                   VCGAALGASGLSWAQVTRYLWAGLTGGAIGPDEVPAYTIVWELRLPRAVLAAVVGAGLS
FT                   AIGVAVQAMVRNALADPFVLGISSGAAVGANAVLIFGALGALGIWALSTAAFLSALLAM
FT                   LLVYAVARTERGLTPLRLVLTGTAMYYGFSAVTTFMVFAAERGEAARSAMMWLLGSLSG
FT                   ANWAAVPIAAGAVLAGLAHLGWSARRLNALALGDETAAALGVDAGRLRKELFLVSAAVT
FT                   GAVVAVSGAIGFVGLMVPHAARMLVGADHRRLLAVAPLAGAVLLIWVDILSRVVLAPAE
FT                   LPVGVLTAVIGVPCFILLMRRRAYSFGGI"
     MATSVDRIPS KPSRPAHDGT GPAPPRRVPL PILLACLCAA LPLSLVCGAA LGASGLSWAQ        60
     VTRYLWAGLT GGAIGPDEVP AYTIVWELRL PRAVLAAVVG AGLSAIGVAV QAMVRNALAD       120
     PFVLGISSGA AVGANAVLIF GALGALGIWA LSTAAFLSAL LAMLLVYAVA RTERGLTPLR       180
     LVLTGTAMYY GFSAVTTFMV FAAERGEAAR SAMMWLLGSL SGANWAAVPI AAGAVLAGLA       240
     HLGWSARRLN ALALGDETAA ALGVDAGRLR KELFLVSAAV TGAVVAVSGA IGFVGLMVPH       300
     AARMLVGADH RRLLAVAPLA GAVLLIWVDI LSRVVLAPAE LPVGVLTAVI GVPCFILLMR       360
     RRAYSFGGI                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page