(data stored in ACNUC7421 zone)

EMBL: AP009493.PE273

AP009493.PE273       Location/Qualifiers
FT   CDS             complement(290246..291286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_273"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_273"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17102"
FT                   /db_xref="GOA:B1VNS9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS9"
FT                   /protein_id="BAG17102.1"
FT                   /translation="MNRRPPSAWTALRRSRALLAVGAAAGPWKRGRGLAVAALLLGLLL
FT                   PLHASIPNGVGNLGSLVETFLPWFGLLIPVLLAGALLRRSLLAGAALLLPAVVWLHLFG
FT                   GLLADKSRQGGDLTVVSHNVGADNPDAVGTARALAAAGADVLALEELDPADRRTYEREL
FT                   ATAYPHHTVLGTVGVWSRLPLSDTRPVDVAMDAGPLGDAKPAEVKLAYNRGLRTTVATD
FT                   HGPLAVYVAHLGSVRVNPRAGLSSGQRDAGARSLGRAVAAERNERVVLLGDLNGTLDDR
FT                   AYAGITSRMRSAQEVAGDGFGFSWPATFPVARIDQILVRGVEPESSWLLPATGSDHLPV
FT                   AARVSW"
     MNRRPPSAWT ALRRSRALLA VGAAAGPWKR GRGLAVAALL LGLLLPLHAS IPNGVGNLGS        60
     LVETFLPWFG LLIPVLLAGA LLRRSLLAGA ALLLPAVVWL HLFGGLLADK SRQGGDLTVV       120
     SHNVGADNPD AVGTARALAA AGADVLALEE LDPADRRTYE RELATAYPHH TVLGTVGVWS       180
     RLPLSDTRPV DVAMDAGPLG DAKPAEVKLA YNRGLRTTVA TDHGPLAVYV AHLGSVRVNP       240
     RAGLSSGQRD AGARSLGRAV AAERNERVVL LGDLNGTLDD RAYAGITSRM RSAQEVAGDG       300
     FGFSWPATFP VARIDQILVR GVEPESSWLL PATGSDHLPV AARVSW                      346
//

If you have problems or comments...

PBIL Back to PBIL home page