(data stored in ACNUC7421 zone)

EMBL: AP009493.PE275

AP009493.PE275       Location/Qualifiers
FT   CDS             292052..293350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_275"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_275"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17104"
FT                   /db_xref="GOA:B1VNT1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT1"
FT                   /protein_id="BAG17104.1"
FT                   /translation="MTRACRHTAVVARRAAGRRLARAIARRRSGLVAELPGHFGNAASV
FT                   RARHRPAGGSVTTDPRRPGLSVRLKLTLSYAGFLMVAGVLLLTAVWVFLLEYVPDDWDR
FT                   RMLHENPNRQLLAYTFAPAAATVLAVLLVVGLLGGWVLAGRMLAPLTRITEATRAATHG
FT                   SLAHRIRLPGRRDEFRELADAFDTMLARLEAHVAEQERFAANASHELRTPLAISRTLLD
FT                   VARADPNRDPDEIIDRLYAVNGRAIDLTEALLVLSRADRRSFARERVDLSLLAEEAAET
FT                   LLPLAEEHGVTVETHGEIAPATGSPALLLQLTTNLVHNAIVHNLPDGGTVRVTASVRPE
FT                   TVVLTVDNTGAKVTPQLAATLTEPFRRGAGRLHTHHAGVGLGLAIVKTITRAHDGTLTL
FT                   VPRPDGGLRVTVELPASAPPADGTGTPYGRMEP"
     MTRACRHTAV VARRAAGRRL ARAIARRRSG LVAELPGHFG NAASVRARHR PAGGSVTTDP        60
     RRPGLSVRLK LTLSYAGFLM VAGVLLLTAV WVFLLEYVPD DWDRRMLHEN PNRQLLAYTF       120
     APAAATVLAV LLVVGLLGGW VLAGRMLAPL TRITEATRAA THGSLAHRIR LPGRRDEFRE       180
     LADAFDTMLA RLEAHVAEQE RFAANASHEL RTPLAISRTL LDVARADPNR DPDEIIDRLY       240
     AVNGRAIDLT EALLVLSRAD RRSFARERVD LSLLAEEAAE TLLPLAEEHG VTVETHGEIA       300
     PATGSPALLL QLTTNLVHNA IVHNLPDGGT VRVTASVRPE TVVLTVDNTG AKVTPQLAAT       360
     LTEPFRRGAG RLHTHHAGVG LGLAIVKTIT RAHDGTLTLV PRPDGGLRVT VELPASAPPA       420
     DGTGTPYGRM EP                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page