(data stored in ACNUC7421 zone)

EMBL: AP009493.PE276

AP009493.PE276       Location/Qualifiers
FT   CDS             293347..293673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_276"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17105"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT2"
FT                   /protein_id="BAG17105.1"
FT                   /translation="MSVVKINVLTVPQEQRETLEKRFASRAHAVESSDGFEWFELLRPV
FT                   EGTDDYLVYTRWRDEASFQAWMEGPMKAAHQGGADGGERPKPAAGGSTVWSFEVVQQAA
FT                   PTGV"
     MSVVKINVLT VPQEQRETLE KRFASRAHAV ESSDGFEWFE LLRPVEGTDD YLVYTRWRDE        60
     ASFQAWMEGP MKAAHQGGAD GGERPKPAAG GSTVWSFEVV QQAAPTGV                    108
//

If you have problems or comments...

PBIL Back to PBIL home page