(data stored in ACNUC7421 zone)

EMBL: AP009493.PE277

AP009493.PE277       Location/Qualifiers
FT   CDS             complement(293789..294334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_277"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17106"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT3"
FT                   /protein_id="BAG17106.1"
FT                   /translation="MCGVNVGTEETRLIVLRGNSASGKSSVAAGLRDRFGRGLAVVGQD
FT                   NLRRTVLRERDRPGAANIGLIDLTARYALDAGYHVVVEGILYADHYGDMLARLRADHRG
FT                   PTHGYYLDVPFAETVARHATKPIADEVDENQLRDWYRPRDVLPDGVETVIGPDSPLTGT
FT                   VDRILRDTGLALLPAVDR"
     MCGVNVGTEE TRLIVLRGNS ASGKSSVAAG LRDRFGRGLA VVGQDNLRRT VLRERDRPGA        60
     ANIGLIDLTA RYALDAGYHV VVEGILYADH YGDMLARLRA DHRGPTHGYY LDVPFAETVA       120
     RHATKPIADE VDENQLRDWY RPRDVLPDGV ETVIGPDSPL TGTVDRILRD TGLALLPAVD       180
     R                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page