(data stored in ACNUC7421 zone)

EMBL: AP009493.PE278

AP009493.PE278       Location/Qualifiers
FT   CDS             294490..307047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_278"
FT                   /product="putative NRPS-type-I PKS fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_278"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17107"
FT                   /db_xref="GOA:B1VNT4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT4"
FT                   /protein_id="BAG17107.1"
FT                   /translation="MEHDMTLLDVLLDAVREAPGQVVVHVRGDGGELTVSLSELLDESL
FT                   RVAGGLRAAGVAPGTCVPLLADRSEDFQPMFWGAVAAGLVPVPLAPDARRVLPVWEHLG
FT                   RPPVVVDASTASLSGELPDDVRALSLDVLREGPALREPVAAGRDDVAFVQFSSGSTGAP
FT                   KGVEVTHGAVLANLEQIRAASELGPEDVVVSWMPYFHDMGLIGTHLAPLAARARQVKIG
FT                   PLSFAKRPRLWFEVAARHRATVLSAANFALALAVRRVPEEVLARLDLSAVRLVLVGAEP
FT                   IAPAVWRAFADRTRPSGLAPAAAQPVYGLAEATLAVTFPPPGEVAEPLVLDRASLSRGV
FT                   AVDAEPGDEAVELMDVGRPVAGCAVRIVDDAGTVLGDRRTGHIMVSGPQLARGYHGLPD
FT                   VSAEVFAGGWLRTGDTGFLRDGRLCVTGRHKDVLFLNGRTFHATDLEEVAAATPGLPSG
FT                   APAVVGSTDPVTGAERVVVFVPWARPAREASEVLERVAARVREALLHDDVRVLALPPGA
FT                   FPRTTSGKLQRRRLRERFEEGVFGSGERRAGEPGAGEVAAGAAGGPPFTEPGRPAAEPR
FT                   ALAPRTRAETVEVVREAWARVLGRPADAIGTHEPFGSIGGTSLKAMEMLVALEDAFGVT
FT                   LPPAVARDHDTVAALAGHLLTVAPGPVLPLADSAKASDTSETSESVVRRTGGTVGGRAP
FT                   ALPDPADAATAVIGMACRFPGADTPEAFWDLLVDGHDAVAPVSRGRWDDGHAAPGARTA
FT                   VPGVAGVPGVPRERWAALLEDPAAFDADFFGIGEDEARTLDPQARIFLELAHEALERAG
FT                   YAGPRRHGHRIGVFAAVGDSGYREVLERARAEGAPLPAALTGNLPSLVAARVSQCLDLD
FT                   GPALAVDTACSSGLVALHLARRSLLDGECDLAVVGGVNLHLTSAPHRLLEEAGALSPTG
FT                   RSRAFSSDADGFVPGEGGAAIVLTRLDAARRADDPVLAVVRGTAVNNDGRSMSLMAPNP
FT                   LRQREVITRAYEAAGVDPAAVTYVEAHGTGTAVGDPIELRSLAHAFPQRPGGEPRLVGS
FT                   VKTNIGHLLNAAALPSLVKVVLALGHRRLPPSLHHTPASPGLAPAGFSVVTKARDWTST
FT                   GPLLAGINAFGFGGTNAHAVLEQAPPPAAPASPPTGEAREVSVEGPHLLTLSAHSPGAL
FT                   RDAVTRLATHLESRPLLREGDVCRTASTSRDEGPHRLAVIAHGDLRERLAAVSAAGTGE
FT                   AGGRGGSPVRSRPRVVFLYPGQGSRFPGQDRALYRTARVFRDTFDEASALLGPVGGRSL
FT                   LDWALDPEVDAAARDATEQAQPLLVASGVALSRQLRAWGVEPDAVAGHSVGELTAACVS
FT                   GVLTLREAVSFAAERGRLMEAFTEPGAMIAVRGGEEAVAAAVAESDGALTVAAYNGPGL
FT                   QVLSGGVRAVESAAARLEGLGVPTRRVRVSRAFHSPLMRPVADRIAEAARALTPRAPSV
FT                   PLMSTVTAEWQPVLGPEYLRDHAERPVLFGAAVERLAREGYDTFVEVGHGATLSGAVRA
FT                   ATGVAAPAGVGGAGASGAAGRPATVLCALPGRSESRADAERRSSEDGHGGRGDLLATIG
FT                   RLWSHGVPLDRTALDAEHRGIPLPTYPYQRRRYWADPPASPLLHRVLWEDSALPGQTAR
FT                   AVRSVLLTGPDPAYVAGLASQLADAGVRTHETGDGPPDAVVLVAGPAPGQDTADALGRA
FT                   QDTALAAFDEALARFDETGADRLLVLTEDVHATGAVRERPRPAHAVLGGLLMALPQETS
FT                   GASATALDLCSLDTPSQRLAAVLAELAEPAASSGPRGGAALVARRAGRRLTRRFAPLPS
FT                   GAAAPAGPGRSPLPPDGTYLITGGGGGIGASLARDLAGRGRPTLVLAGRSPGLPEGLSE
FT                   ELRALGATVDYRMADVSVEQDVEALLAGLGHLDGLFHAAGAVRPGTLRDRRAEETAEAL
FT                   AAKTRGTLLLSLALRRHGLDPAVRVVFSSVSAVLPGLAGALGDYAGANAFLDAFAASER
FT                   HAGRPWQSVNLAAVAGTGMAAALGTGAWPATGGGPAAGASAGGRPVALRPALAALRTAC
FT                   GVDAAQLLLADLTPFREPTVMTDRTAPAAVAGPGDSPASGTDSSGTVSGTAQPPGAGPR
FT                   TGSGPRGDTAGGTAALLRRLLASALRLPDAAVPDDEPFLALGLDSLAAVDLVRQLEREL
FT                   GRTLPATLFFEYRTVAELAAHLDTTPSLLRSPASAPPAVPDGVAFPLTPVQLALHTSSR
FT                   LHPDVPAHGYVRQTVRGPLDTGLLGRALTALADRHAMLRIRVQQTGSLGSGDDGISGGT
FT                   GSATPGQYVAPPAPLSAWYEVREPAGRIEEVETALCNRPFDLSAEPPVRALLARESPEL
FT                   SHLVLVIHHAAGDGYSLNVLAGELWSLYTSLAEGQAPTLPALATDFARYAVATAEARSA
FT                   TDGTRALAADRLYWSGRLAARGEPLRLPYDGDPSALPAAPVNTHQSALGPVPTAALERR
FT                   AAAHGVSLFHLLLAVHVRCLARWSGQREIAVNVARARRDDRMAGLDRLVGPLADTLPLL
FT                   CATDPDEPVETLAERLAGIWLESERHASLTGLDLARLLPTDPSGAGPRTVSPAGFSFSR
FT                   FPAALDGRCPVSVRPTAAGTATAATRLSLLCWQDEAVLRFSWNFPARLFAPATVARLDR
FT                   DFHAELTALVEPRPGLPAVPGPVQVPAPGTGSATLVRRLVERFRATPDAVAVDTGATTL
FT                   TYAELDRASHALAASLLARGVTGGSLVGLLTEPGADTVVAVVAVLRAGAGWVPLDPGHP
FT                   AARLTDQLTRSGARTVVCHAATRAVGEALGDVALVVADVSALAYRGAGVPGSVPGPDRV
FT                   AGTLRSPEAAPAPDGPADADAIAYVIFTSGSTGRPKAVPITHRSMENYLDWAIGTFGYD
FT                   EHDRLAQTASPCFDASVRQLLAPLLVGATVVTVAWDLLRDPDRLLTHVVRGRITVWSSV
FT                   PTLWEQLLSASEERVRNGAPPPDLSALRWIHVGGEALSPAHVRRWFDLFGDGQHIANLY
FT                   GPTEATINTSCHIIRARPGDQVRRLPIGRPVAGTEVEVVGPDGEPAGPGEAGELLISGV
FT                   GLTPGYLGEPALTEAAFTVRRGRRWYRSGDRVRCSEDGVLEFLGRLDDQVKIRGNRVEP
FT                   GEIEAVLQTHPDVAHAVVLAGDGRLTAFVTPGPGAAGADAAGLRLHLAQSLPAYMLPSR
FT                   ITRVDRMPLTGTGKIDRRALPALQEAAAPPGADTNAGPAARTGDVRTPPRTPTEVRLAA
FT                   IWTALLQTDDVSREDDFFVLGGDSLLVLEVFARLEKQGGPLPRPTVVYRNRTLAALAAA
FT                   VDVAAGAAAESGEPTGVAARAAADPSAGEPGAGDDRTGAPDPSVTPLPFPLTPTQRGFL
FT                   LAEAIAPGATSSWLTRLRLHGRLDTARFQSAVDTLVERHPMLRTVFPAGARPAVQQELP
FT                   SSLRLPVDFEVLTDPAQVEERVTAERARRFEPWAWPLMRLRVLTTAPDEHVLVAHAHHI
FT                   IGDGYSAALLVRELTAVYDALSRGEEPASGRPRSTFRDHALHLAARTDARTAPPAATAS
FT                   GTTAGRDSVAPAKSPRQGVPAVQDRWERLNAPYAQPRLAAGTTTAGAPRDAVAPLFHTC
FT                   GFTVEADRVEALRGLAARTGSTLHAPVLTAYYRALVSATGRADLVLGMAVSGRDHALPD
FT                   AHRVFGPFATAVPLRPAGPASGRPGSADFDDDLRRVAAEAAEARTYEGPVPPLSNGLPM
FT                   TSQFFFTYLDFSALGPEVGRTLTVTREGGDSVYTPPPAGTDVFLAAAPEGGRLRITVRA
FT                   AATAFTPKALAAFTDSVRDGLARAAASTAAEAGRPDRPASGRDGRMDAALVGYLPSPAD
FT                   LARLAGLPETALPREQLRTLLFPDGLPRLLETLRTPLGRSGFVCVPLFADELAPGDDLL
FT                   GHTTRGVELASSLGARAVSLAGMIPSLTGYGFDVLRAVGTTEAVTTTGPAVTTGHAATV
FT                   LSVVRTVHAALDATGQRLGSLTVAFVGLGSIGSSSLELLLTRSQQPPARLLLCDVPGSG
FT                   PRLKELAESLLERGLVEVVEVVESGHGLPDAVYDARLIVAAVSGGGALLDIDRLAPGTT
FT                   VVDDSFPHCFDTSRAVGRMERSKDVLVVGGGLLSAGPAERQVAEGLPAAAVAGYLARPM
FT                   VPDTIASCRLESLLHASGAGVPLVHGPVDAATGLAYWEAAEATGIRAAPLHLLTRTVDP
FT                   DMFTRHPWSS"
     MEHDMTLLDV LLDAVREAPG QVVVHVRGDG GELTVSLSEL LDESLRVAGG LRAAGVAPGT        60
     CVPLLADRSE DFQPMFWGAV AAGLVPVPLA PDARRVLPVW EHLGRPPVVV DASTASLSGE       120
     LPDDVRALSL DVLREGPALR EPVAAGRDDV AFVQFSSGST GAPKGVEVTH GAVLANLEQI       180
     RAASELGPED VVVSWMPYFH DMGLIGTHLA PLAARARQVK IGPLSFAKRP RLWFEVAARH       240
     RATVLSAANF ALALAVRRVP EEVLARLDLS AVRLVLVGAE PIAPAVWRAF ADRTRPSGLA       300
     PAAAQPVYGL AEATLAVTFP PPGEVAEPLV LDRASLSRGV AVDAEPGDEA VELMDVGRPV       360
     AGCAVRIVDD AGTVLGDRRT GHIMVSGPQL ARGYHGLPDV SAEVFAGGWL RTGDTGFLRD       420
     GRLCVTGRHK DVLFLNGRTF HATDLEEVAA ATPGLPSGAP AVVGSTDPVT GAERVVVFVP       480
     WARPAREASE VLERVAARVR EALLHDDVRV LALPPGAFPR TTSGKLQRRR LRERFEEGVF       540
     GSGERRAGEP GAGEVAAGAA GGPPFTEPGR PAAEPRALAP RTRAETVEVV REAWARVLGR       600
     PADAIGTHEP FGSIGGTSLK AMEMLVALED AFGVTLPPAV ARDHDTVAAL AGHLLTVAPG       660
     PVLPLADSAK ASDTSETSES VVRRTGGTVG GRAPALPDPA DAATAVIGMA CRFPGADTPE       720
     AFWDLLVDGH DAVAPVSRGR WDDGHAAPGA RTAVPGVAGV PGVPRERWAA LLEDPAAFDA       780
     DFFGIGEDEA RTLDPQARIF LELAHEALER AGYAGPRRHG HRIGVFAAVG DSGYREVLER       840
     ARAEGAPLPA ALTGNLPSLV AARVSQCLDL DGPALAVDTA CSSGLVALHL ARRSLLDGEC       900
     DLAVVGGVNL HLTSAPHRLL EEAGALSPTG RSRAFSSDAD GFVPGEGGAA IVLTRLDAAR       960
     RADDPVLAVV RGTAVNNDGR SMSLMAPNPL RQREVITRAY EAAGVDPAAV TYVEAHGTGT      1020
     AVGDPIELRS LAHAFPQRPG GEPRLVGSVK TNIGHLLNAA ALPSLVKVVL ALGHRRLPPS      1080
     LHHTPASPGL APAGFSVVTK ARDWTSTGPL LAGINAFGFG GTNAHAVLEQ APPPAAPASP      1140
     PTGEAREVSV EGPHLLTLSA HSPGALRDAV TRLATHLESR PLLREGDVCR TASTSRDEGP      1200
     HRLAVIAHGD LRERLAAVSA AGTGEAGGRG GSPVRSRPRV VFLYPGQGSR FPGQDRALYR      1260
     TARVFRDTFD EASALLGPVG GRSLLDWALD PEVDAAARDA TEQAQPLLVA SGVALSRQLR      1320
     AWGVEPDAVA GHSVGELTAA CVSGVLTLRE AVSFAAERGR LMEAFTEPGA MIAVRGGEEA      1380
     VAAAVAESDG ALTVAAYNGP GLQVLSGGVR AVESAAARLE GLGVPTRRVR VSRAFHSPLM      1440
     RPVADRIAEA ARALTPRAPS VPLMSTVTAE WQPVLGPEYL RDHAERPVLF GAAVERLARE      1500
     GYDTFVEVGH GATLSGAVRA ATGVAAPAGV GGAGASGAAG RPATVLCALP GRSESRADAE      1560
     RRSSEDGHGG RGDLLATIGR LWSHGVPLDR TALDAEHRGI PLPTYPYQRR RYWADPPASP      1620
     LLHRVLWEDS ALPGQTARAV RSVLLTGPDP AYVAGLASQL ADAGVRTHET GDGPPDAVVL      1680
     VAGPAPGQDT ADALGRAQDT ALAAFDEALA RFDETGADRL LVLTEDVHAT GAVRERPRPA      1740
     HAVLGGLLMA LPQETSGASA TALDLCSLDT PSQRLAAVLA ELAEPAASSG PRGGAALVAR      1800
     RAGRRLTRRF APLPSGAAAP AGPGRSPLPP DGTYLITGGG GGIGASLARD LAGRGRPTLV      1860
     LAGRSPGLPE GLSEELRALG ATVDYRMADV SVEQDVEALL AGLGHLDGLF HAAGAVRPGT      1920
     LRDRRAEETA EALAAKTRGT LLLSLALRRH GLDPAVRVVF SSVSAVLPGL AGALGDYAGA      1980
     NAFLDAFAAS ERHAGRPWQS VNLAAVAGTG MAAALGTGAW PATGGGPAAG ASAGGRPVAL      2040
     RPALAALRTA CGVDAAQLLL ADLTPFREPT VMTDRTAPAA VAGPGDSPAS GTDSSGTVSG      2100
     TAQPPGAGPR TGSGPRGDTA GGTAALLRRL LASALRLPDA AVPDDEPFLA LGLDSLAAVD      2160
     LVRQLERELG RTLPATLFFE YRTVAELAAH LDTTPSLLRS PASAPPAVPD GVAFPLTPVQ      2220
     LALHTSSRLH PDVPAHGYVR QTVRGPLDTG LLGRALTALA DRHAMLRIRV QQTGSLGSGD      2280
     DGISGGTGSA TPGQYVAPPA PLSAWYEVRE PAGRIEEVET ALCNRPFDLS AEPPVRALLA      2340
     RESPELSHLV LVIHHAAGDG YSLNVLAGEL WSLYTSLAEG QAPTLPALAT DFARYAVATA      2400
     EARSATDGTR ALAADRLYWS GRLAARGEPL RLPYDGDPSA LPAAPVNTHQ SALGPVPTAA      2460
     LERRAAAHGV SLFHLLLAVH VRCLARWSGQ REIAVNVARA RRDDRMAGLD RLVGPLADTL      2520
     PLLCATDPDE PVETLAERLA GIWLESERHA SLTGLDLARL LPTDPSGAGP RTVSPAGFSF      2580
     SRFPAALDGR CPVSVRPTAA GTATAATRLS LLCWQDEAVL RFSWNFPARL FAPATVARLD      2640
     RDFHAELTAL VEPRPGLPAV PGPVQVPAPG TGSATLVRRL VERFRATPDA VAVDTGATTL      2700
     TYAELDRASH ALAASLLARG VTGGSLVGLL TEPGADTVVA VVAVLRAGAG WVPLDPGHPA      2760
     ARLTDQLTRS GARTVVCHAA TRAVGEALGD VALVVADVSA LAYRGAGVPG SVPGPDRVAG      2820
     TLRSPEAAPA PDGPADADAI AYVIFTSGST GRPKAVPITH RSMENYLDWA IGTFGYDEHD      2880
     RLAQTASPCF DASVRQLLAP LLVGATVVTV AWDLLRDPDR LLTHVVRGRI TVWSSVPTLW      2940
     EQLLSASEER VRNGAPPPDL SALRWIHVGG EALSPAHVRR WFDLFGDGQH IANLYGPTEA      3000
     TINTSCHIIR ARPGDQVRRL PIGRPVAGTE VEVVGPDGEP AGPGEAGELL ISGVGLTPGY      3060
     LGEPALTEAA FTVRRGRRWY RSGDRVRCSE DGVLEFLGRL DDQVKIRGNR VEPGEIEAVL      3120
     QTHPDVAHAV VLAGDGRLTA FVTPGPGAAG ADAAGLRLHL AQSLPAYMLP SRITRVDRMP      3180
     LTGTGKIDRR ALPALQEAAA PPGADTNAGP AARTGDVRTP PRTPTEVRLA AIWTALLQTD      3240
     DVSREDDFFV LGGDSLLVLE VFARLEKQGG PLPRPTVVYR NRTLAALAAA VDVAAGAAAE      3300
     SGEPTGVAAR AAADPSAGEP GAGDDRTGAP DPSVTPLPFP LTPTQRGFLL AEAIAPGATS      3360
     SWLTRLRLHG RLDTARFQSA VDTLVERHPM LRTVFPAGAR PAVQQELPSS LRLPVDFEVL      3420
     TDPAQVEERV TAERARRFEP WAWPLMRLRV LTTAPDEHVL VAHAHHIIGD GYSAALLVRE      3480
     LTAVYDALSR GEEPASGRPR STFRDHALHL AARTDARTAP PAATASGTTA GRDSVAPAKS      3540
     PRQGVPAVQD RWERLNAPYA QPRLAAGTTT AGAPRDAVAP LFHTCGFTVE ADRVEALRGL      3600
     AARTGSTLHA PVLTAYYRAL VSATGRADLV LGMAVSGRDH ALPDAHRVFG PFATAVPLRP      3660
     AGPASGRPGS ADFDDDLRRV AAEAAEARTY EGPVPPLSNG LPMTSQFFFT YLDFSALGPE      3720
     VGRTLTVTRE GGDSVYTPPP AGTDVFLAAA PEGGRLRITV RAAATAFTPK ALAAFTDSVR      3780
     DGLARAAAST AAEAGRPDRP ASGRDGRMDA ALVGYLPSPA DLARLAGLPE TALPREQLRT      3840
     LLFPDGLPRL LETLRTPLGR SGFVCVPLFA DELAPGDDLL GHTTRGVELA SSLGARAVSL      3900
     AGMIPSLTGY GFDVLRAVGT TEAVTTTGPA VTTGHAATVL SVVRTVHAAL DATGQRLGSL      3960
     TVAFVGLGSI GSSSLELLLT RSQQPPARLL LCDVPGSGPR LKELAESLLE RGLVEVVEVV      4020
     ESGHGLPDAV YDARLIVAAV SGGGALLDID RLAPGTTVVD DSFPHCFDTS RAVGRMERSK      4080
     DVLVVGGGLL SAGPAERQVA EGLPAAAVAG YLARPMVPDT IASCRLESLL HASGAGVPLV      4140
     HGPVDAATGL AYWEAAEATG IRAAPLHLLT RTVDPDMFTR HPWSS                      4185
//

If you have problems or comments...

PBIL Back to PBIL home page