(data stored in ACNUC7421 zone)

EMBL: AP009493.PE279

AP009493.PE279       Location/Qualifiers
FT   CDS             307143..307688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_279"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17108"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT5"
FT                   /protein_id="BAG17108.1"
FT                   /translation="MVRTSPFACMGVGALSVWEKSSTARVMPPARPRKLAKVPFVELAD
FT                   GRLQGVVSSGSDIGRVYVSSVTARTYAFACSTNNNRPCGGARGMFCKHIQALVGEAVLQ
FT                   YGAERVARYLAVETPDGEPDAHSVTAAMTAARPVRGDSAAAAQVFSRFLRQLAYLELDA
FT                   VTSPLPEMQWFPPTRAVA"
     MVRTSPFACM GVGALSVWEK SSTARVMPPA RPRKLAKVPF VELADGRLQG VVSSGSDIGR        60
     VYVSSVTART YAFACSTNNN RPCGGARGMF CKHIQALVGE AVLQYGAERV ARYLAVETPD       120
     GEPDAHSVTA AMTAARPVRG DSAAAAQVFS RFLRQLAYLE LDAVTSPLPE MQWFPPTRAV       180
     A                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page