(data stored in ACNUC7421 zone)

EMBL: AP009493.PE280

AP009493.PE280       Location/Qualifiers
FT   CDS             307688..309091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17109"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT6"
FT                   /protein_id="BAG17109.1"
FT                   /translation="MRGDLLSDPVEGLDEALAVVDAFDEALVAGLLRPGPAQAAAVVGL
FT                   AEAVAGTPLAARVAEAADRAKAGAAGEDHFVALAAARCALLGSVHDALTQRIDEAVGRP
FT                   AAEDGAAGPGPASAAADRGSNLLAAARSWLCDLARAGWRGIDHERVAGAAPVVSAMLPD
FT                   PVLRRRATLLDGFAAELAASCPGATLERVPLRRWADLWSRALLLTVPGSAGESAVTPVS
FT                   GRLLPLGVDVQEHATAVQAQVHAVFEPADGGVPRLVRAGVAAPKPDTVVGAGLWQLLRP
FT                   RMSLLGAVSEGRSMELDAMPVTAEGDLLWDDGRARPGEPADAFATARVMLSTAAAARVA
FT                   PLDRHPVRIAVPVLLEGYTARSEDDRLVFDLPGRSLAVDTDRAPAAGPLTPEAVAASHS
FT                   CVGLLRWDAGEFLLQPLAVEATVRKKAVAAHAGAWAGGTTDKAGVRAEKAATDAVTVLR
FT                   ERAGRLLRK"
     MRGDLLSDPV EGLDEALAVV DAFDEALVAG LLRPGPAQAA AVVGLAEAVA GTPLAARVAE        60
     AADRAKAGAA GEDHFVALAA ARCALLGSVH DALTQRIDEA VGRPAAEDGA AGPGPASAAA       120
     DRGSNLLAAA RSWLCDLARA GWRGIDHERV AGAAPVVSAM LPDPVLRRRA TLLDGFAAEL       180
     AASCPGATLE RVPLRRWADL WSRALLLTVP GSAGESAVTP VSGRLLPLGV DVQEHATAVQ       240
     AQVHAVFEPA DGGVPRLVRA GVAAPKPDTV VGAGLWQLLR PRMSLLGAVS EGRSMELDAM       300
     PVTAEGDLLW DDGRARPGEP ADAFATARVM LSTAAAARVA PLDRHPVRIA VPVLLEGYTA       360
     RSEDDRLVFD LPGRSLAVDT DRAPAAGPLT PEAVAASHSC VGLLRWDAGE FLLQPLAVEA       420
     TVRKKAVAAH AGAWAGGTTD KAGVRAEKAA TDAVTVLRER AGRLLRK                     467
//

If you have problems or comments...

PBIL Back to PBIL home page