(data stored in ACNUC7421 zone)

EMBL: AP009493.PE281

AP009493.PE281       Location/Qualifiers
FT   CDS             309088..310479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_281"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17110"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT7"
FT                   /protein_id="BAG17110.1"
FT                   /translation="MTEHRTGQPPGSAGPGPSPAAPDPYDNRRQVLYWRLLARLFDGEE
FT                   QPALESASLEVVEDIGLPSALLDPGTSLDSVVQRHPELAAKFDGLMTPGDGAADDRDRA
FT                   AEVRRAALVSKVLLNVFARGSSTVTAEQLARWQSDADWLERALGCPPGGLRGGRAAGAG
FT                   PAGGGLGPELAAIEADLVGRMRLREVLADPALAARLTPSMSLIEQLLRDKGNLSGVALA
FT                   NAKSLIRRYVDEVAEVLRTQVEKATVGELDRSVPPKRVFRNLDLDRTIWKNLTNWSPEE
FT                   ERLYVDRLYYRHTVRRTTPQRLIVVVDQSGSMVDSMVNCTVLASIFAGLPKVDVHLIAY
FT                   DTRSIDLTPWVHDPFDVLLRTNLGGGNDGPVAMAMARPKIAEPRNTVMVWISDFYEFDR
FT                   SQPLFEGIEAVHRSGVKFIPVGSVTSSGRQEVNPWFRERFKALGTPVVSGHVSQLVHEL
FT                   KTFLT"
     MTEHRTGQPP GSAGPGPSPA APDPYDNRRQ VLYWRLLARL FDGEEQPALE SASLEVVEDI        60
     GLPSALLDPG TSLDSVVQRH PELAAKFDGL MTPGDGAADD RDRAAEVRRA ALVSKVLLNV       120
     FARGSSTVTA EQLARWQSDA DWLERALGCP PGGLRGGRAA GAGPAGGGLG PELAAIEADL       180
     VGRMRLREVL ADPALAARLT PSMSLIEQLL RDKGNLSGVA LANAKSLIRR YVDEVAEVLR       240
     TQVEKATVGE LDRSVPPKRV FRNLDLDRTI WKNLTNWSPE EERLYVDRLY YRHTVRRTTP       300
     QRLIVVVDQS GSMVDSMVNC TVLASIFAGL PKVDVHLIAY DTRSIDLTPW VHDPFDVLLR       360
     TNLGGGNDGP VAMAMARPKI AEPRNTVMVW ISDFYEFDRS QPLFEGIEAV HRSGVKFIPV       420
     GSVTSSGRQE VNPWFRERFK ALGTPVVSGH VSQLVHELKT FLT                         463
//

If you have problems or comments...

PBIL Back to PBIL home page