(data stored in ACNUC7421 zone)

EMBL: AP009493.PE282

AP009493.PE282       Location/Qualifiers
FT   CDS             310562..311713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_282"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17111"
FT                   /db_xref="GOA:B1VNT8"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT8"
FT                   /protein_id="BAG17111.1"
FT                   /translation="MFQKGLLMSDVLRAPAETKYAEELDWLESIDDSPKPFSWRLSPKM
FT                   VRLFILGSERADGLDREIPQKWFGDRSLVERSIVTLASDRGLLLIGDPGTGKSWLAELL
FT                   SAAISRNSTLVVQGTAGTTEDHIKYAWNVSMVIARGQSRESMIPSPIMTAMETGAIGRF
FT                   EELTRSTSDVQDALISILSEKYISVPELRNDGVDGGDNIVFAKPGFSIIATANSRDRGV
FT                   NDLSSALKRRFNFVRIPVVTNRKSEAEIVRFRTEELLRRHAIDLDVPPTLLDILLQSFA
FT                   DLRASAAAAGSDDEKLESALSTAEQIGVLEDAVLHSNFFGESTLTARTLASSLVGSLAR
FT                   RDPEDLAIFNKYLHGVVEPRGKEEGGSWQEFLDGGRDTIATLS"
     MFQKGLLMSD VLRAPAETKY AEELDWLESI DDSPKPFSWR LSPKMVRLFI LGSERADGLD        60
     REIPQKWFGD RSLVERSIVT LASDRGLLLI GDPGTGKSWL AELLSAAISR NSTLVVQGTA       120
     GTTEDHIKYA WNVSMVIARG QSRESMIPSP IMTAMETGAI GRFEELTRST SDVQDALISI       180
     LSEKYISVPE LRNDGVDGGD NIVFAKPGFS IIATANSRDR GVNDLSSALK RRFNFVRIPV       240
     VTNRKSEAEI VRFRTEELLR RHAIDLDVPP TLLDILLQSF ADLRASAAAA GSDDEKLESA       300
     LSTAEQIGVL EDAVLHSNFF GESTLTARTL ASSLVGSLAR RDPEDLAIFN KYLHGVVEPR       360
     GKEEGGSWQE FLDGGRDTIA TLS                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page