(data stored in ACNUC7421 zone)

EMBL: AP009493.PE283

AP009493.PE283       Location/Qualifiers
FT   CDS             311710..314568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_283"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17112"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT9"
FT                   /protein_id="BAG17112.1"
FT                   /translation="MSGSPTDGLGENAPGETSFAALRGQLHEAAAAFADGPDALEGILL
FT                   GMVDDVDRAVREPLEIFPVCHHSPASALAMARRLREKQPKVVYLELCEDMAPLLDELRN
FT                   CRLPVAVQAFASDIDGFPAEWAPLSVVAPITEASAEYQAIAYALDTPGVELVLVDRSSD
FT                   HVFQWDGRHGERAPEGASGAADGSPEPEAALHGEAVGVEIGDLRPRFAELEEHLLRHGK
FT                   VRHWSEWWHQYVEIPLGDSDHAAYRQVMFLVGSLFRRLAPGDGERLRVDEDRERYMWTR
FT                   MREHLASSGADPEDCLYVCGAFHAASRVEEFGVAGGGSFSISPRSATTWQHGLIPSSHA
FT                   AIEAQFGLATGSVSIAATQWTKNLERTRIQPYRLAGQDGAKKPRTSGRAAPALPAPPPE
FT                   AAADRLSGFLRRPPVLDTLDEAELLGWSVGIVRAARRGGYLASTADAIAVFETSILLAG
FT                   MRDRAKPTPYDFQDAAITCIEKDAVPGRRDVRRLVEIMMGGDRIGRVGYDALPPLARDV
FT                   HDRLAPLELKLQQRGVQRALLDMNARPELGACSDVLWMLRRLMPHGTARPIMGERKLGE
FT                   RSIQESWDLALGTHQRALIELGYEGVSIEQVLEQRLRRDAYGPRATTAAVLAAVEDATL
FT                   YLGGRRLADELGARALEVLAAERTVDGAPEVLRRVRGLLAYYRTGEPVLPPWVESFVKT
FT                   GYAHYCTLLPTAFTDEDVTAGQVAAMLGFLFSMEGLALSLGCDRAQLELAVAQSRPTDP
FT                   ERTALLWAAQVQLGALTRAELRERCGELLANPMVVPAYPRYLSGFVHALVPVPGLADVV
FT                   VEAVSNAFGRLPDAVLLPWLPTLITTLRAGAADLAPLLIREAGRIFPARLPALDAWVPP
FT                   WREVPEAGAPVVGRANAAGDGGRGAALVFAHPAALDAVAQLLGCDGAWAASGAGGARPG
FT                   GVVLAARHPETASAWESLLTGA"
     MSGSPTDGLG ENAPGETSFA ALRGQLHEAA AAFADGPDAL EGILLGMVDD VDRAVREPLE        60
     IFPVCHHSPA SALAMARRLR EKQPKVVYLE LCEDMAPLLD ELRNCRLPVA VQAFASDIDG       120
     FPAEWAPLSV VAPITEASAE YQAIAYALDT PGVELVLVDR SSDHVFQWDG RHGERAPEGA       180
     SGAADGSPEP EAALHGEAVG VEIGDLRPRF AELEEHLLRH GKVRHWSEWW HQYVEIPLGD       240
     SDHAAYRQVM FLVGSLFRRL APGDGERLRV DEDRERYMWT RMREHLASSG ADPEDCLYVC       300
     GAFHAASRVE EFGVAGGGSF SISPRSATTW QHGLIPSSHA AIEAQFGLAT GSVSIAATQW       360
     TKNLERTRIQ PYRLAGQDGA KKPRTSGRAA PALPAPPPEA AADRLSGFLR RPPVLDTLDE       420
     AELLGWSVGI VRAARRGGYL ASTADAIAVF ETSILLAGMR DRAKPTPYDF QDAAITCIEK       480
     DAVPGRRDVR RLVEIMMGGD RIGRVGYDAL PPLARDVHDR LAPLELKLQQ RGVQRALLDM       540
     NARPELGACS DVLWMLRRLM PHGTARPIMG ERKLGERSIQ ESWDLALGTH QRALIELGYE       600
     GVSIEQVLEQ RLRRDAYGPR ATTAAVLAAV EDATLYLGGR RLADELGARA LEVLAAERTV       660
     DGAPEVLRRV RGLLAYYRTG EPVLPPWVES FVKTGYAHYC TLLPTAFTDE DVTAGQVAAM       720
     LGFLFSMEGL ALSLGCDRAQ LELAVAQSRP TDPERTALLW AAQVQLGALT RAELRERCGE       780
     LLANPMVVPA YPRYLSGFVH ALVPVPGLAD VVVEAVSNAF GRLPDAVLLP WLPTLITTLR       840
     AGAADLAPLL IREAGRIFPA RLPALDAWVP PWREVPEAGA PVVGRANAAG DGGRGAALVF       900
     AHPAALDAVA QLLGCDGAWA ASGAGGARPG GVVLAARHPE TASAWESLLT GA               952
//

If you have problems or comments...

PBIL Back to PBIL home page