(data stored in ACNUC7421 zone)

EMBL: AP009493.PE284

AP009493.PE284       Location/Qualifiers
FT   CDS             314758..315645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_284"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17113"
FT                   /db_xref="GOA:B1VNU0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNU0"
FT                   /protein_id="BAG17113.1"
FT                   /translation="MTHVAQELASQPDCWQVAAGMADGLAHRLPAAGERIAVIGCGTSY
FT                   FMAQAYAALREGSGRGETDAFAASEFPAGRPYDRVVALSRSGTTTEVLELLGRIGDTSR
FT                   RTVVIGDPDTPMAAMADDTIVLEFADEKSVVQTRFATSALTLLRAHLGLHTDAVVEDAQ
FT                   VALAEPLPSGLVECSQFTFLGQGWSVGLAHEAALKMREAALAWTEAYPAMEYRHGPISI
FT                   STRSTATWMLGEAPSGLMDEVHATGARWVAGGLDPLAELVRVQRLALAIANARGLDPDR
FT                   PRHLTRSVILSSTV"
     MTHVAQELAS QPDCWQVAAG MADGLAHRLP AAGERIAVIG CGTSYFMAQA YAALREGSGR        60
     GETDAFAASE FPAGRPYDRV VALSRSGTTT EVLELLGRIG DTSRRTVVIG DPDTPMAAMA       120
     DDTIVLEFAD EKSVVQTRFA TSALTLLRAH LGLHTDAVVE DAQVALAEPL PSGLVECSQF       180
     TFLGQGWSVG LAHEAALKMR EAALAWTEAY PAMEYRHGPI SISTRSTATW MLGEAPSGLM       240
     DEVHATGARW VAGGLDPLAE LVRVQRLALA IANARGLDPD RPRHLTRSVI LSSTV            295
//

If you have problems or comments...

PBIL Back to PBIL home page