(data stored in ACNUC7421 zone)

EMBL: AP009493.PE288

AP009493.PE288       Location/Qualifiers
FT   CDS             complement(318589..319392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_288"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_288"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17117"
FT                   /db_xref="GOA:B1VNU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNU4"
FT                   /protein_id="BAG17117.1"
FT                   /translation="MIYAAWMSLYREESSGLGFGGTERAFAGFGNFTEALGSEAFLRSF
FT                   GNIALYCALYIPAMVGGALVLALLVDSTMARARRFFQIAYFLPHAVPGLIASLIWLYLY
FT                   TPGLSPITDALDALGAQWNFFGQDEAIFSVVNISAWQWTGYNMIIFYAGLQAVPREVLE
FT                   AATVDGAGALRTALQVKIPMIRPTVVLTLLFTCVGAIQLFDAPKLVQLRANTMGEDWSP
FT                   TMFIYTAAFKGHDYGLAAASSLLLALVAGLLSFVVTKLGNRWKAS"
     MIYAAWMSLY REESSGLGFG GTERAFAGFG NFTEALGSEA FLRSFGNIAL YCALYIPAMV        60
     GGALVLALLV DSTMARARRF FQIAYFLPHA VPGLIASLIW LYLYTPGLSP ITDALDALGA       120
     QWNFFGQDEA IFSVVNISAW QWTGYNMIIF YAGLQAVPRE VLEAATVDGA GALRTALQVK       180
     IPMIRPTVVL TLLFTCVGAI QLFDAPKLVQ LRANTMGEDW SPTMFIYTAA FKGHDYGLAA       240
     ASSLLLALVA GLLSFVVTKL GNRWKAS                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page