(data stored in ACNUC7421 zone)

EMBL: AP009493.PE293

AP009493.PE293       Location/Qualifiers
FT   CDS             326141..326653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_293"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17122"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNU9"
FT                   /protein_id="BAG17122.1"
FT                   /translation="MTDDERIAPPLLGGERETLRAFLDYQRETLAMKCAGLDDDALRER
FT                   SMPPSALSLLALVRHLAEVERAWFRRVFEDGAAPMVWSAEPFDFQAAYDASASTGAEAF
FT                   AAWKAEVEISRRIEREADSLDLVGRQPRWGKEVSLRMVMVHVLVEYGRHNGHADLLREG
FT                   VDGTVGA"
     MTDDERIAPP LLGGERETLR AFLDYQRETL AMKCAGLDDD ALRERSMPPS ALSLLALVRH        60
     LAEVERAWFR RVFEDGAAPM VWSAEPFDFQ AAYDASASTG AEAFAAWKAE VEISRRIERE       120
     ADSLDLVGRQ PRWGKEVSLR MVMVHVLVEY GRHNGHADLL REGVDGTVGA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page