(data stored in ACNUC7421 zone)

EMBL: AP009493.PE296

AP009493.PE296       Location/Qualifiers
FT   CDS             complement(327873..328307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_296"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17125"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV2"
FT                   /protein_id="BAG17125.1"
FT                   /translation="MNAEHRPPDSRHRRPEGVTDATVEALGALSKALETAERARGALYD
FT                   FHQLTGSADLALDDAVRLLRAAGHGRHAERVEREILGRNVIPGHWTFQIVEEYNATYYD
FT                   VFRTIEGGIRQELAEGRDHLHEAEMKAARRTEGHPDHTAE"
     MNAEHRPPDS RHRRPEGVTD ATVEALGALS KALETAERAR GALYDFHQLT GSADLALDDA        60
     VRLLRAAGHG RHAERVEREI LGRNVIPGHW TFQIVEEYNA TYYDVFRTIE GGIRQELAEG       120
     RDHLHEAEMK AARRTEGHPD HTAE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page