(data stored in ACNUC7421 zone)

EMBL: AP009493.PE297

AP009493.PE297       Location/Qualifiers
FT   CDS             328499..329005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_297"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17126"
FT                   /db_xref="GOA:B1VNV3"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV3"
FT                   /protein_id="BAG17126.1"
FT                   /translation="MRNDEQELYSVGEVAELLGLHVRTVRNYVRDGRLKAVRIGKQYRI
FT                   NKEDLAALTGRPTDATVPKPAPAPGHAEVSSIVEIDALGPDAAHRLGTFITASTQSGRE
FT                   ASRPLRIQTVYDEERTRMKIVILGGTAATADLLHMIDGLLDPDSGLFASAPTSTSSSAQ
FT                   RADHA"
     MRNDEQELYS VGEVAELLGL HVRTVRNYVR DGRLKAVRIG KQYRINKEDL AALTGRPTDA        60
     TVPKPAPAPG HAEVSSIVEI DALGPDAAHR LGTFITASTQ SGREASRPLR IQTVYDEERT       120
     RMKIVILGGT AATADLLHMI DGLLDPDSGL FASAPTSTSS SAQRADHA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page