(data stored in ACNUC7421 zone)

EMBL: AP009493.PE298

AP009493.PE298       Location/Qualifiers
FT   CDS             328998..329423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_298"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17127"
FT                   /db_xref="InterPro:IPR025438"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV4"
FT                   /protein_id="BAG17127.1"
FT                   /translation="MPELVEYHGVPVLVCDASGDTIADVQDALDHLIGAAFTSAEVVAV
FT                   PSARLDDRFFDLSTGLAGAILQTCANYRLRLVVLGDIGHHLSAGSALSDLVSEANRGRD
FT                   IWFLSDLDALADRMAPNGDRRPSGRVDRPRDGAHRPG"
     MPELVEYHGV PVLVCDASGD TIADVQDALD HLIGAAFTSA EVVAVPSARL DDRFFDLSTG        60
     LAGAILQTCA NYRLRLVVLG DIGHHLSAGS ALSDLVSEAN RGRDIWFLSD LDALADRMAP       120
     NGDRRPSGRV DRPRDGAHRP G                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page