(data stored in ACNUC7421 zone)

EMBL: AP009493.PE299

AP009493.PE299       Location/Qualifiers
FT   CDS             complement(329513..330484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_299"
FT                   /product="putative sporulation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_299"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17128"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV5"
FT                   /protein_id="BAG17128.1"
FT                   /translation="MVFKKLLGALGVGGPSVDTVLEPGPALPGAVLTGEVRLRGGGSDV
FT                   TVDRISLLLVARVEREDQDEEHEGTVVLERFTVGGGFRLAEEAEHAVPFSVTLPWETPI
FT                   TELHGQHLGPVLGIRTELEIAGARDKGDLDALAVGPLPAQEAILEAFGQLGYAFRSADL
FT                   ELGHIRGTGQQLPCYQEIEILPPAGHAHAVNEIEVTFIAAPGGLEVVIEADKRAGLFSD
FT                   GHDTVHRFTASHHGVPHTDWNAQVDAWLKEVIAGHETRATPSSGFGHHGDQHRSGPGAG
FT                   AVVAGVAAGVAVGVVGGMVAAEVVDEIGDAFEEEEGEEGDEG"
     MVFKKLLGAL GVGGPSVDTV LEPGPALPGA VLTGEVRLRG GGSDVTVDRI SLLLVARVER        60
     EDQDEEHEGT VVLERFTVGG GFRLAEEAEH AVPFSVTLPW ETPITELHGQ HLGPVLGIRT       120
     ELEIAGARDK GDLDALAVGP LPAQEAILEA FGQLGYAFRS ADLELGHIRG TGQQLPCYQE       180
     IEILPPAGHA HAVNEIEVTF IAAPGGLEVV IEADKRAGLF SDGHDTVHRF TASHHGVPHT       240
     DWNAQVDAWL KEVIAGHETR ATPSSGFGHH GDQHRSGPGA GAVVAGVAAG VAVGVVGGMV       300
     AAEVVDEIGD AFEEEEGEEG DEG                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page