(data stored in ACNUC7421 zone)

EMBL: AP009493.PE30

AP009493.PE30        Location/Qualifiers
FT   CDS             34981..35865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_30t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_30t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16859"
FT                   /db_xref="InterPro:IPR005506"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKN3"
FT                   /protein_id="BAG16859.1"
FT                   /translation="MVLLMKALKLLGPWHQEAAARALSGTDQDVLDYLRTRWKEANHND
FT                   IRQRVVELSTQSPYTSVRTVATEVLSGTPAQSPYTSVRTVATEVLSGTPAQIEAFYTDG
FT                   QYEAGIDDMKVDVARLTSTGGPGVAEAAKAALRNGSALALAKFLKIGQYGEHITDERVT
FT                   AARLTNTGGPEVVAAATTALAGDSGQAQAVSAVPGCVVADPAADLAANGLRLPASDPAG
FT                   RVRRPRTVRGRGTRLACVHPGPAAEPSRGRADESEPEPGASGVHRAGSGATRAPGVRAG
FT                   RGVRPAGGSAGAG"
     MVLLMKALKL LGPWHQEAAA RALSGTDQDV LDYLRTRWKE ANHNDIRQRV VELSTQSPYT        60
     SVRTVATEVL SGTPAQSPYT SVRTVATEVL SGTPAQIEAF YTDGQYEAGI DDMKVDVARL       120
     TSTGGPGVAE AAKAALRNGS ALALAKFLKI GQYGEHITDE RVTAARLTNT GGPEVVAAAT       180
     TALAGDSGQA QAVSAVPGCV VADPAADLAA NGLRLPASDP AGRVRRPRTV RGRGTRLACV       240
     HPGPAAEPSR GRADESEPEP GASGVHRAGS GATRAPGVRA GRGVRPAGGS AGAG             294
//

If you have problems or comments...

PBIL Back to PBIL home page