(data stored in ACNUC7421 zone)

EMBL: AP009493.PE300

AP009493.PE300       Location/Qualifiers
FT   CDS             330872..332209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_300"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17129"
FT                   /db_xref="GOA:B1VNV6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV6"
FT                   /protein_id="BAG17129.1"
FT                   /translation="MSEVALLLLALALTLACAVFVAAEFSLTTVERSELERAVRAGERG
FT                   AESALKAAKRLTFQLSGAQLGITVTSLVIGMLAEPSLAVLLRGPLEGAGLPSGAVSTVA
FT                   TLLGVAASTVVLMVIGELVPKNWAISSPLTVAKVVSTPQRAFTACFAPLIRHLNNSANR
FT                   FVRRLGLEPAEELASARTPQELIALAQHSAREGAIEQDSAELFVRTLHLAELSAENVMT
FT                   PRVDVRALEAHATAADAANLTLATGLSRFPVYRDSLDEVIGTVHIRDVLALDESERGRT
FT                   PVTALATEPLLVPDSLPVDRLLAQLRKRRTMAVVIDEYGGTAGVATVEDIVEEVVGEVR
FT                   DEHDPHERPDLAPAEPLGDGRPVWEAEGSIRLDQLDRIGFGAPEGPYETLAGLLANQLA
FT                   RIPVRTDRVEVDGWQFDVLDIEHHRADRVRITAPAPAPALVEEDAR"
     MSEVALLLLA LALTLACAVF VAAEFSLTTV ERSELERAVR AGERGAESAL KAAKRLTFQL        60
     SGAQLGITVT SLVIGMLAEP SLAVLLRGPL EGAGLPSGAV STVATLLGVA ASTVVLMVIG       120
     ELVPKNWAIS SPLTVAKVVS TPQRAFTACF APLIRHLNNS ANRFVRRLGL EPAEELASAR       180
     TPQELIALAQ HSAREGAIEQ DSAELFVRTL HLAELSAENV MTPRVDVRAL EAHATAADAA       240
     NLTLATGLSR FPVYRDSLDE VIGTVHIRDV LALDESERGR TPVTALATEP LLVPDSLPVD       300
     RLLAQLRKRR TMAVVIDEYG GTAGVATVED IVEEVVGEVR DEHDPHERPD LAPAEPLGDG       360
     RPVWEAEGSI RLDQLDRIGF GAPEGPYETL AGLLANQLAR IPVRTDRVEV DGWQFDVLDI       420
     EHHRADRVRI TAPAPAPALV EEDAR                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page