(data stored in ACNUC7421 zone)

EMBL: AP009493.PE301

AP009493.PE301       Location/Qualifiers
FT   CDS             332206..333222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_301"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_301"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17130"
FT                   /db_xref="GOA:B1VNV7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV7"
FT                   /protein_id="BAG17130.1"
FT                   /translation="MTTVQLAIGVLTLLTNAFFVGAEFALISVRRSQIEPQAVRGSRRA
FT                   KSALWGLEHLSAAMATAQLGITISSLVLGAVAEPAIAHLLEPPFDAVGVPDALVHPIAF
FT                   VIALTLATYLHMLIGEMIPKNIALAAPVATALALGPPLVGLTRALRPVIFGINAFANML
FT                   LRLLKVDPKDEVASVFTDDELVRLVKDSSEAGLLAPADGERLRDALELGTRPVGEVMVP
FT                   LNRTVTVELGITPQGLERAAVASGFSRLPVTGPDDGLLGYFHIKDALGVAERTKALPTS
FT                   ALHPVIRVEIDTPLDDTLTAMRAAGTHLAAVAGGKGTVIGFVTMEDVLDELVGAAAV"
     MTTVQLAIGV LTLLTNAFFV GAEFALISVR RSQIEPQAVR GSRRAKSALW GLEHLSAAMA        60
     TAQLGITISS LVLGAVAEPA IAHLLEPPFD AVGVPDALVH PIAFVIALTL ATYLHMLIGE       120
     MIPKNIALAA PVATALALGP PLVGLTRALR PVIFGINAFA NMLLRLLKVD PKDEVASVFT       180
     DDELVRLVKD SSEAGLLAPA DGERLRDALE LGTRPVGEVM VPLNRTVTVE LGITPQGLER       240
     AAVASGFSRL PVTGPDDGLL GYFHIKDALG VAERTKALPT SALHPVIRVE IDTPLDDTLT       300
     AMRAAGTHLA AVAGGKGTVI GFVTMEDVLD ELVGAAAV                               338
//

If you have problems or comments...

PBIL Back to PBIL home page