(data stored in ACNUC7421 zone)

EMBL: AP009493.PE302

AP009493.PE302       Location/Qualifiers
FT   CDS             333348..333968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_302"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17131"
FT                   /db_xref="GOA:B1VNV8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV8"
FT                   /protein_id="BAG17131.1"
FT                   /translation="MAKYFDVHPANPQPRTISTVVDSIRSGALVAYPTDSCYALGCQLG
FT                   NRDALGRIRSIRNLDDKHHFTLVCHDFAQLSQFVRVDNDVFRAVKAATPGSYTFILPAT
FT                   KEVPRQLLHPKKKTVGVRIPDHVVTQALVAELGEPLLSSTLLLPDEAEPLTQGWEIKER
FT                   LEHEVDAVIDSGDCGTELTTVIDFSGDEPEIVRRGAGDTSRFE"
     MAKYFDVHPA NPQPRTISTV VDSIRSGALV AYPTDSCYAL GCQLGNRDAL GRIRSIRNLD        60
     DKHHFTLVCH DFAQLSQFVR VDNDVFRAVK AATPGSYTFI LPATKEVPRQ LLHPKKKTVG       120
     VRIPDHVVTQ ALVAELGEPL LSSTLLLPDE AEPLTQGWEI KERLEHEVDA VIDSGDCGTE       180
     LTTVIDFSGD EPEIVRRGAG DTSRFE                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page