(data stored in ACNUC7421 zone)

EMBL: AP009493.PE303

AP009493.PE303       Location/Qualifiers
FT   CDS             334043..334669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_303"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17132"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV9"
FT                   /protein_id="BAG17132.1"
FT                   /translation="MGVTGERLRFDGWIAGVGTVSGTRLVVGHWPRSPFGAFSDVMVEH
FT                   PGGERVLLAPSRPIADFVAATYRFDRIEVVPVAVTVAGDSWLVEAGALRLRLRTGRRSA
FT                   LGLLLSAVPSPFARSPLWAALCDVPARLLMPGVRTLGRAGPGRREWYGARGLRPVVAAD
FT                   AVLDGASLGGLAPLDPPVAFGFGSAPRRPSLVRVTTTVELATAER"
     MGVTGERLRF DGWIAGVGTV SGTRLVVGHW PRSPFGAFSD VMVEHPGGER VLLAPSRPIA        60
     DFVAATYRFD RIEVVPVAVT VAGDSWLVEA GALRLRLRTG RRSALGLLLS AVPSPFARSP       120
     LWAALCDVPA RLLMPGVRTL GRAGPGRREW YGARGLRPVV AADAVLDGAS LGGLAPLDPP       180
     VAFGFGSAPR RPSLVRVTTT VELATAER                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page