(data stored in ACNUC7421 zone)

EMBL: AP009493.PE304

AP009493.PE304       Location/Qualifiers
FT   CDS             334786..335010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_304"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17133"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNW0"
FT                   /protein_id="BAG17133.1"
FT                   /translation="MANPPIVIHRPTPSGGRRVTVHYEGRDEILGLAHSDHDVIVFLNE
FT                   AGLEEADRILDNPVWVEWRGGRAHHYEAA"
     MANPPIVIHR PTPSGGRRVT VHYEGRDEIL GLAHSDHDVI VFLNEAGLEE ADRILDNPVW        60
     VEWRGGRAHH YEAA                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page