(data stored in ACNUC7421 zone)

EMBL: AP009493.PE306

AP009493.PE306       Location/Qualifiers
FT   CDS             complement(335600..337276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_306"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_306"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17135"
FT                   /db_xref="GOA:B1VNW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNW2"
FT                   /protein_id="BAG17135.1"
FT                   /translation="MSHPTAPGASVAASNLTFRWPDGTHLFDGLSLTVPRGRTGLAGAN
FT                   GAGKSTLLRLFAGLLRPSQGSVTVGGNLAHLPQNITLDTSLRVDAALGIGERRAALRAI
FT                   ESGDVREEHFETVGDDWDVEERALATLGSLGLGAVELDRTVGQLSGGETVLLRLAALLL
FT                   ERPDVLLLDEPTNNLDLFARRRLYDAVDSWRTGILIVVSHDRDLLERVDRIAELRSGSV
FT                   SWYGGGWSAYQEALATQQEAAGRMLRAADADVRRQQRELEETRIKVARRQRHDKKLDGQ
FT                   RKAPRIVAGERKRSAQESGDRLRGLHEDRLDEARERREEAAEAVRRDAEIKVSLPHTAV
FT                   PSGRTVLTVRDLSLPYGRLREGSLHVQGPERVALVGRNGAGKTTFLRTLTGELPPSTGE
FT                   ATTAVPLKFLPQRLDVLDDALSVADNVARTAPGTTDNQIRSQLARFLFKGARAEQPAGT
FT                   LSGGERFRAALAATMLAAPAPQLLLLDEPTNNLDLASVRQLTSALESYEGALVIASHDL
FT                   PFLDSVGITRWVLLDDTLRETDAEEVRALFGNPESTPAGTA"
     MSHPTAPGAS VAASNLTFRW PDGTHLFDGL SLTVPRGRTG LAGANGAGKS TLLRLFAGLL        60
     RPSQGSVTVG GNLAHLPQNI TLDTSLRVDA ALGIGERRAA LRAIESGDVR EEHFETVGDD       120
     WDVEERALAT LGSLGLGAVE LDRTVGQLSG GETVLLRLAA LLLERPDVLL LDEPTNNLDL       180
     FARRRLYDAV DSWRTGILIV VSHDRDLLER VDRIAELRSG SVSWYGGGWS AYQEALATQQ       240
     EAAGRMLRAA DADVRRQQRE LEETRIKVAR RQRHDKKLDG QRKAPRIVAG ERKRSAQESG       300
     DRLRGLHEDR LDEARERREE AAEAVRRDAE IKVSLPHTAV PSGRTVLTVR DLSLPYGRLR       360
     EGSLHVQGPE RVALVGRNGA GKTTFLRTLT GELPPSTGEA TTAVPLKFLP QRLDVLDDAL       420
     SVADNVARTA PGTTDNQIRS QLARFLFKGA RAEQPAGTLS GGERFRAALA ATMLAAPAPQ       480
     LLLLDEPTNN LDLASVRQLT SALESYEGAL VIASHDLPFL DSVGITRWVL LDDTLRETDA       540
     EEVRALFGNP ESTPAGTA                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page