(data stored in ACNUC7421 zone)

EMBL: AP009493.PE309

AP009493.PE309       Location/Qualifiers
FT   CDS             339776..340396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_309"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17138"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ37"
FT                   /protein_id="BAG17138.1"
FT                   /translation="MILPPRLIPLLDQFDFACERLLARLSGPAMDSGNGVEIGVTPLGD
FT                   DEHLWEPVPDCWSVRRRGDAPGARATVLAGAGAWGRDAAESPHPFPPPFTTIAWRLSHL
FT                   AEMLTLRADHTSGGRTLTRDGYRTPGDAAGAVAAFGTASAAWREALLTADDTALDTIGY
FT                   STYPNGSDAEDPFVDIVWWVNQEVLHHGAEIALLRDLYRARPT"
     MILPPRLIPL LDQFDFACER LLARLSGPAM DSGNGVEIGV TPLGDDEHLW EPVPDCWSVR        60
     RRGDAPGARA TVLAGAGAWG RDAAESPHPF PPPFTTIAWR LSHLAEMLTL RADHTSGGRT       120
     LTRDGYRTPG DAAGAVAAFG TASAAWREAL LTADDTALDT IGYSTYPNGS DAEDPFVDIV       180
     WWVNQEVLHH GAEIALLRDL YRARPT                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page