(data stored in ACNUC7421 zone)

EMBL: AP009493.PE31

AP009493.PE31        Location/Qualifiers
FT   CDS             35633..36628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_31t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_31t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16860"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKN4"
FT                   /protein_id="BAG16860.1"
FT                   /translation="MTLLDAFAGPGRYEAGEPGSPVFILDRLLNHHAVERMNLSRSRVH
FT                   LVFIERDPARHEHLVSELVAVFGPLEDLPVRVEVRRGEAGKDSLPVLTELGAWGNPILG
FT                   IFDSWGSVNVPLKVMARIARNRSSEVITTFGPNWFSRREELNADLLDTVFGGRGFWMPA
FT                   ADEARSDERWRAWLGTYRNALKRAGFGYQLQFQLVPRTGQPLYLVFGTGSDAGLRAMKD
FT                   AMWKVDDRDGESFRDPRNRGGAVAGQIDLFQMEETLDPELVELVTQRLERGDVTVEAVG
FT                   RWLLTETSRWMSTHALKAARVMRQDGSLVVQSAGKLTNKSVVGLPAPVRS"
     MTLLDAFAGP GRYEAGEPGS PVFILDRLLN HHAVERMNLS RSRVHLVFIE RDPARHEHLV        60
     SELVAVFGPL EDLPVRVEVR RGEAGKDSLP VLTELGAWGN PILGIFDSWG SVNVPLKVMA       120
     RIARNRSSEV ITTFGPNWFS RREELNADLL DTVFGGRGFW MPAADEARSD ERWRAWLGTY       180
     RNALKRAGFG YQLQFQLVPR TGQPLYLVFG TGSDAGLRAM KDAMWKVDDR DGESFRDPRN       240
     RGGAVAGQID LFQMEETLDP ELVELVTQRL ERGDVTVEAV GRWLLTETSR WMSTHALKAA       300
     RVMRQDGSLV VQSAGKLTNK SVVGLPAPVR S                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page