(data stored in ACNUC7421 zone)

EMBL: AP009493.PE310

AP009493.PE310       Location/Qualifiers
FT   CDS             340504..341337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17139"
FT                   /db_xref="GOA:B1VQ38"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ38"
FT                   /protein_id="BAG17139.1"
FT                   /translation="MNRRRTPRSASAEDLLNTLQDLTARARREVEFHQARVELAQALQR
FT                   DMLPAALPAVPGLQSAARYAPARHGLDIGGDWYDGFPLADGALGFAIGDVQGHDVEAAA
FT                   FMGQVRIAMRAIAGTASDPGEILGRTNDLLVSVDSGLFATCTFMRLDPATWELHSARAG
FT                   HVACVWATTEGRSGVTEDPGGLPLGIEPGEGYPVTRRTLDSDGAIVLLTDGVVEGPSLR
FT                   IEDGLERVRGLVAAHAGSSAGRLADEVLGAAEVTGHEDDAAVLVLRHAAAHRGPR"
     MNRRRTPRSA SAEDLLNTLQ DLTARARREV EFHQARVELA QALQRDMLPA ALPAVPGLQS        60
     AARYAPARHG LDIGGDWYDG FPLADGALGF AIGDVQGHDV EAAAFMGQVR IAMRAIAGTA       120
     SDPGEILGRT NDLLVSVDSG LFATCTFMRL DPATWELHSA RAGHVACVWA TTEGRSGVTE       180
     DPGGLPLGIE PGEGYPVTRR TLDSDGAIVL LTDGVVEGPS LRIEDGLERV RGLVAAHAGS       240
     SAGRLADEVL GAAEVTGHED DAAVLVLRHA AAHRGPR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page