(data stored in ACNUC7421 zone)

EMBL: AP009493.PE314

AP009493.PE314       Location/Qualifiers
FT   CDS             344872..345249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_314"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17143"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ42"
FT                   /protein_id="BAG17143.1"
FT                   /translation="MIAQVECVALDCPDPKELAGFYLSLLGGEVDRTDRRWACDADWST
FT                   LHTPGGLVLAFQRVADHRPPGWPGQDPPQQFHLDFGVTDQEEAHEVVLACGGSVLDAGD
FT                   EARGWRVYADPAGHPFCLVRH"
     MIAQVECVAL DCPDPKELAG FYLSLLGGEV DRTDRRWACD ADWSTLHTPG GLVLAFQRVA        60
     DHRPPGWPGQ DPPQQFHLDF GVTDQEEAHE VVLACGGSVL DAGDEARGWR VYADPAGHPF       120
     CLVRH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page