(data stored in ACNUC7421 zone)

EMBL: AP009493.PE315

AP009493.PE315       Location/Qualifiers
FT   CDS             complement(345343..345684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_315"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17144"
FT                   /db_xref="GOA:B1VQ43"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ43"
FT                   /protein_id="BAG17144.1"
FT                   /translation="MKPEKDCARGLAQLEGFLLWNAEIERARRQARLFTHQLPWLTTAQ
FT                   REDVERVFIAERVAASRESLIRVRDRADELREEYTGRYARLRVRCVAVSAGAVGAATCL
FT                   GTVLMLALR"
     MKPEKDCARG LAQLEGFLLW NAEIERARRQ ARLFTHQLPW LTTAQREDVE RVFIAERVAA        60
     SRESLIRVRD RADELREEYT GRYARLRVRC VAVSAGAVGA ATCLGTVLML ALR              113
//

If you have problems or comments...

PBIL Back to PBIL home page