(data stored in ACNUC7421 zone)

EMBL: AP009493.PE316

AP009493.PE316       Location/Qualifiers
FT   CDS             complement(345734..347542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_316"
FT                   /product="putative cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_316"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17145"
FT                   /db_xref="GOA:B1VQ44"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ44"
FT                   /protein_id="BAG17145.1"
FT                   /translation="MSHRTDLRGSILVAESTRAVDRRSVVVTTRGISQSVETDTADQDE
FT                   MPVRRGEPGNVVVKWMTTTDHKTIGTLYLVTSFAFFCVGGLMALVMRAELARPGIQLIS
FT                   NEQFNQAFTMHGTIMLLMFATPLFAGFANWIMPLQIGAPDVAFPRLNMFAYWLYLFGSL
FT                   IAVAGFLTPQGAADFGWFAYSPLNDAVRSPGIGADMWIMGLAFSGFGTILGSVNFITTI
FT                   ICMRAPGMTMFRMPIFVWNVLLTGVLVLLAFPVLAAALLALEADRKFGAHVFDAANGGA
FT                   LLWQHLFWFFGHPEVYIIALPFFGIVTEILPVFSRKPVFGYIGLVAATIAIAGLSATVW
FT                   AHHMFVTGGVLLPFFSFMTFLIAVPTGVKFFNWIGTMWKGSLSLETPMLWSVGFLVTFL
FT                   FGGLTGIILASPPLDFHVSDSYFVVAHFHYVVFGTVVFAMFAGFHFWWPKFTGKMLDER
FT                   LGKMTFWTLFVGFHGTFLVQHWLGAEGMPRRYADYLEADGFTALNTISTISSFLLGLSI
FT                   LPFFYNIWKTAKYGRKIEVDDPWGYGRSLEWATSCPPPRHNFVTLPRIRSESPAFDLHH
FT                   PDVRSLEQVTNRPQNSTIVAPGDQHE"
     MSHRTDLRGS ILVAESTRAV DRRSVVVTTR GISQSVETDT ADQDEMPVRR GEPGNVVVKW        60
     MTTTDHKTIG TLYLVTSFAF FCVGGLMALV MRAELARPGI QLISNEQFNQ AFTMHGTIML       120
     LMFATPLFAG FANWIMPLQI GAPDVAFPRL NMFAYWLYLF GSLIAVAGFL TPQGAADFGW       180
     FAYSPLNDAV RSPGIGADMW IMGLAFSGFG TILGSVNFIT TIICMRAPGM TMFRMPIFVW       240
     NVLLTGVLVL LAFPVLAAAL LALEADRKFG AHVFDAANGG ALLWQHLFWF FGHPEVYIIA       300
     LPFFGIVTEI LPVFSRKPVF GYIGLVAATI AIAGLSATVW AHHMFVTGGV LLPFFSFMTF       360
     LIAVPTGVKF FNWIGTMWKG SLSLETPMLW SVGFLVTFLF GGLTGIILAS PPLDFHVSDS       420
     YFVVAHFHYV VFGTVVFAMF AGFHFWWPKF TGKMLDERLG KMTFWTLFVG FHGTFLVQHW       480
     LGAEGMPRRY ADYLEADGFT ALNTISTISS FLLGLSILPF FYNIWKTAKY GRKIEVDDPW       540
     GYGRSLEWAT SCPPPRHNFV TLPRIRSESP AFDLHHPDVR SLEQVTNRPQ NSTIVAPGDQ       600
     HE                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page