(data stored in ACNUC7421 zone)

EMBL: AP009493.PE319

AP009493.PE319       Location/Qualifiers
FT   CDS             complement(348854..349624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_319"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17148"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ47"
FT                   /protein_id="BAG17148.1"
FT                   /translation="MSADPDRPEESRLEESQYGESRHDERRYEEEDERLGCGRLLADVW
FT                   EAWDTGRSAEDPHFAPCPFCSAALADLTGLDDAVRRTCEQEPGTPDTTAITARVMDLVR
FT                   LELRPGRPLPLGEPGEDHWMVESAVARILRSAVDSLPGVRAGSCRIAPLDPADPTGDLH
FT                   VRVEVAASVGRPLRDLADAVRARVAEVADRDIGIRLAAIDVLVVDILDTVDTLDVFYEG
FT                   GGHRVYGDGDGEDGTVTGGHANGRADGHGTGATR"
     MSADPDRPEE SRLEESQYGE SRHDERRYEE EDERLGCGRL LADVWEAWDT GRSAEDPHFA        60
     PCPFCSAALA DLTGLDDAVR RTCEQEPGTP DTTAITARVM DLVRLELRPG RPLPLGEPGE       120
     DHWMVESAVA RILRSAVDSL PGVRAGSCRI APLDPADPTG DLHVRVEVAA SVGRPLRDLA       180
     DAVRARVAEV ADRDIGIRLA AIDVLVVDIL DTVDTLDVFY EGGGHRVYGD GDGEDGTVTG       240
     GHANGRADGH GTGATR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page