(data stored in ACNUC7421 zone)

EMBL: AP009493.PE32

AP009493.PE32        Location/Qualifiers
FT   CDS             complement(36707..37474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_32t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_32t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16861"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKN5"
FT                   /protein_id="BAG16861.1"
FT                   /translation="MSDRSSIEWTEATWNPTTGCDRVSAGCDNCYALTLSKRLKAMGSP
FT                   KYQNDGDPRTSGPGFGLTVHPQALTVPLRWRAPRTVFVNSMSDLFHARVPLDYVRRVFE
FT                   VMASTPQHTYQVLTKRARRVRQLADRLEWPENLWMGVSVESVKELPRVEDLRQVPAAVK
FT                   FLSCEPLIGPLPGLEVSGIDWVIVGGESGTGARSTDLQWASDIVETCQASGTSVFVKQL
FT                   GSGWNKALHKDIDQFPAALRVREYPRARHGAPA"
     MSDRSSIEWT EATWNPTTGC DRVSAGCDNC YALTLSKRLK AMGSPKYQND GDPRTSGPGF        60
     GLTVHPQALT VPLRWRAPRT VFVNSMSDLF HARVPLDYVR RVFEVMASTP QHTYQVLTKR       120
     ARRVRQLADR LEWPENLWMG VSVESVKELP RVEDLRQVPA AVKFLSCEPL IGPLPGLEVS       180
     GIDWVIVGGE SGTGARSTDL QWASDIVETC QASGTSVFVK QLGSGWNKAL HKDIDQFPAA       240
     LRVREYPRAR HGAPA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page