(data stored in ACNUC7421 zone)

EMBL: AP009493.PE321

AP009493.PE321       Location/Qualifiers
FT   CDS             350601..351125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_321"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17150"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ49"
FT                   /protein_id="BAG17150.1"
FT                   /translation="MTTIQPAATVPSAGTASRTGTTKQSGSASGTTTVGSGATGAAEPA
FT                   ATRGRTSIADTVVVKIAGMAAREIPGVHDMGGGLSRTLGAVRDRVPGGRPNVGRGVKVE
FT                   VGERQTAIDVDLVVEYGVAITDVAHDVRENVIAAVERTTGLEVVEVNVTVNDVHLPEDD
FT                   DEVASSETRVA"
     MTTIQPAATV PSAGTASRTG TTKQSGSASG TTTVGSGATG AAEPAATRGR TSIADTVVVK        60
     IAGMAAREIP GVHDMGGGLS RTLGAVRDRV PGGRPNVGRG VKVEVGERQT AIDVDLVVEY       120
     GVAITDVAHD VRENVIAAVE RTTGLEVVEV NVTVNDVHLP EDDDEVASSE TRVA             174
//

If you have problems or comments...

PBIL Back to PBIL home page