(data stored in ACNUC7421 zone)

EMBL: AP009493.PE323

AP009493.PE323       Location/Qualifiers
FT   CDS             351354..352412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_323"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17152"
FT                   /db_xref="GOA:B1VQ51"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ51"
FT                   /protein_id="BAG17152.1"
FT                   /translation="MTVPAAGRGTTTVTPRAVRRIAERAASEALPDGGTVTSGSASVHG
FT                   ASARVKVGVRLPYPLPADEAAERIQERARTRTAALTGLSVPHADVRINSLSVHPLPPAR
FT                   TPSGDEPRGTADAARGARGTVRSGGPGGRIRAQRRIPSALTAAVGAIGCALLLVDVIAV
FT                   RLGDAPAAWRTWLVDWASTHGPADTAVRFGGVLAALTGAWLLGCALLPGQRRRLTMAAP
FT                   APGLRAALDRSAAARVVQDRTAAVGGVVRVLVRVRRRRVKVLAEVGYGAPEQVRAEVVR
FT                   VVQAALPELGLARTPTLRVGIRVRRAPQGPPPSAEKPRQSTTASTTATPTPAPAPAPAP
FT                   APAPAPAQQREV"
     MTVPAAGRGT TTVTPRAVRR IAERAASEAL PDGGTVTSGS ASVHGASARV KVGVRLPYPL        60
     PADEAAERIQ ERARTRTAAL TGLSVPHADV RINSLSVHPL PPARTPSGDE PRGTADAARG       120
     ARGTVRSGGP GGRIRAQRRI PSALTAAVGA IGCALLLVDV IAVRLGDAPA AWRTWLVDWA       180
     STHGPADTAV RFGGVLAALT GAWLLGCALL PGQRRRLTMA APAPGLRAAL DRSAAARVVQ       240
     DRTAAVGGVV RVLVRVRRRR VKVLAEVGYG APEQVRAEVV RVVQAALPEL GLARTPTLRV       300
     GIRVRRAPQG PPPSAEKPRQ STTASTTATP TPAPAPAPAP APAPAPAQQR EV               352
//

If you have problems or comments...

PBIL Back to PBIL home page