(data stored in ACNUC7421 zone)

EMBL: AP009493.PE324

AP009493.PE324       Location/Qualifiers
FT   CDS             352417..353007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_324"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17153"
FT                   /db_xref="GOA:B1VQ52"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ52"
FT                   /protein_id="BAG17153.1"
FT                   /translation="MSVTGRGRVNRSLLGAVGLLLLVCGGWLALGDGSAWVPMVDRVPQ
FT                   WWPTPAPDGVLLDRDLTARLREKGWWSPALITGLALALVLLLWWLAHQARPGRARWSVL
FT                   PRSGPVLRRRAWERAMTTQIAAYDDVARARVRIVGRPPRAVVAVVVEPGSRPAQVVRSV
FT                   AAVIADARDSVGVRSLSADIRVRIVNRRERRTR"
     MSVTGRGRVN RSLLGAVGLL LLVCGGWLAL GDGSAWVPMV DRVPQWWPTP APDGVLLDRD        60
     LTARLREKGW WSPALITGLA LALVLLLWWL AHQARPGRAR WSVLPRSGPV LRRRAWERAM       120
     TTQIAAYDDV ARARVRIVGR PPRAVVAVVV EPGSRPAQVV RSVAAVIADA RDSVGVRSLS       180
     ADIRVRIVNR RERRTR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page