(data stored in ACNUC7421 zone)

EMBL: AP009493.PE325

AP009493.PE325       Location/Qualifiers
FT   CDS             353208..353726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_325"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17154"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ53"
FT                   /protein_id="BAG17154.1"
FT                   /translation="MPRTMSVADSIVIDASPAQVYEQLSDPTAMGRWSPENRGATVRGE
FT                   QRAAYVGMVFEGRNKRGAARWTTRCTVTAADPGERFAFRVHAIGLRRPLLPGPIATWDY
FT                   RFEAVDGATRVTETWTDDRRRWPDFLANAFDRVATGGKTFAQFQGGNIRTTLKRLKAAL
FT                   EADARGTGS"
     MPRTMSVADS IVIDASPAQV YEQLSDPTAM GRWSPENRGA TVRGEQRAAY VGMVFEGRNK        60
     RGAARWTTRC TVTAADPGER FAFRVHAIGL RRPLLPGPIA TWDYRFEAVD GATRVTETWT       120
     DDRRRWPDFL ANAFDRVATG GKTFAQFQGG NIRTTLKRLK AALEADARGT GS               172
//

If you have problems or comments...

PBIL Back to PBIL home page