(data stored in ACNUC7421 zone)

EMBL: AP009493.PE326

AP009493.PE326       Location/Qualifiers
FT   CDS             complement(353767..354609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_326"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17155"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ54"
FT                   /protein_id="BAG17155.1"
FT                   /translation="MPDNEPRTMPDNGRGALRADCANCFALCCVALTLTASTDFAIDKD
FT                   AGRPCPNLRDDFRCGIHTRLRPKGFSGCTVYDCFGAGQQVSQVTYGGRDWRSSPDIAAQ
FT                   MFQVFPVMRQLHELLWYLTEALTLPDARPLHDEIRRALDETERHTGRPAVDFSDLDIAG
FT                   HRDRVAGLLLRTSERVRAAAPRRKRRNHRGADLIGARLRGADLRAADLRGAYLIAADLT
FT                   GADLRLADLIGADFRDADLSDADLTGSLFLTQAQLNAAKGNGKTALPASLSRPPHWAT"
     MPDNEPRTMP DNGRGALRAD CANCFALCCV ALTLTASTDF AIDKDAGRPC PNLRDDFRCG        60
     IHTRLRPKGF SGCTVYDCFG AGQQVSQVTY GGRDWRSSPD IAAQMFQVFP VMRQLHELLW       120
     YLTEALTLPD ARPLHDEIRR ALDETERHTG RPAVDFSDLD IAGHRDRVAG LLLRTSERVR       180
     AAAPRRKRRN HRGADLIGAR LRGADLRAAD LRGAYLIAAD LTGADLRLAD LIGADFRDAD       240
     LSDADLTGSL FLTQAQLNAA KGNGKTALPA SLSRPPHWAT                             280
//

If you have problems or comments...

PBIL Back to PBIL home page