(data stored in ACNUC7421 zone)

EMBL: AP009493.PE327

AP009493.PE327       Location/Qualifiers
FT   CDS             354815..355312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_327"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17156"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ55"
FT                   /protein_id="BAG17156.1"
FT                   /translation="MGTEESNGFEPATGEGPPPSEPAATRAATVRTAFEGLLQIRRLTG
FT                   SGHPDPVAVPAPWERNRPIRAIALALERSGATPSAVDASGRRVSAGYRVSSGESPGSVR
FT                   VEWIGPPGSGAAHGEEEALAGCASALRDLGWTVLLYRGPRRRRYLEVEPPSELSGGHGR
FT                   PS"
     MGTEESNGFE PATGEGPPPS EPAATRAATV RTAFEGLLQI RRLTGSGHPD PVAVPAPWER        60
     NRPIRAIALA LERSGATPSA VDASGRRVSA GYRVSSGESP GSVRVEWIGP PGSGAAHGEE       120
     EALAGCASAL RDLGWTVLLY RGPRRRRYLE VEPPSELSGG HGRPS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page