(data stored in ACNUC7421 zone)

EMBL: AP009493.PE328

AP009493.PE328       Location/Qualifiers
FT   CDS             355378..355605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_328"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17157"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ56"
FT                   /protein_id="BAG17157.1"
FT                   /translation="MDSDELAAAQAYVRLLEATRAVLADPEDAPVYLPLLTSPMREADR
FT                   ALRSAGLTGNEDRLFALVRAIQPSFSGSDR"
     MDSDELAAAQ AYVRLLEATR AVLADPEDAP VYLPLLTSPM READRALRSA GLTGNEDRLF        60
     ALVRAIQPSF SGSDR                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page