(data stored in ACNUC7421 zone)

EMBL: AP009493.PE33

AP009493.PE33        Location/Qualifiers
FT   CDS             complement(37663..38538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_33t"
FT                   /product="putative Tra3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_33t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16862"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL7"
FT                   /protein_id="BAG16862.1"
FT                   /translation="MTNVDTPTSQPEDTAPELSGADLARIALHQAREAAKKRGASESRA
FT                   PRRHRTRTVRPSGREPSGFAAVLQTLMTDRAWELPAASGTVLDRWPDIAATITPHLADR
FT                   VQALAFHAETGQLDLLPESPAYATQLRLISARIITAANETTGTGTVRTIRVLPPGTAPA
FT                   DRSPLPASPVPAPVAPGAPVKTRETAADGYHQALTAHRTTWNTTRQHTNPKVQAAAQRQ
FT                   LRDRIRESEERFAEGRRALEELQTKAAAQQQVGSSDAARARALQRLAAERAGLPTITPV
FT                   AAPERLDRTA"
     MTNVDTPTSQ PEDTAPELSG ADLARIALHQ AREAAKKRGA SESRAPRRHR TRTVRPSGRE        60
     PSGFAAVLQT LMTDRAWELP AASGTVLDRW PDIAATITPH LADRVQALAF HAETGQLDLL       120
     PESPAYATQL RLISARIITA ANETTGTGTV RTIRVLPPGT APADRSPLPA SPVPAPVAPG       180
     APVKTRETAA DGYHQALTAH RTTWNTTRQH TNPKVQAAAQ RQLRDRIRES EERFAEGRRA       240
     LEELQTKAAA QQQVGSSDAA RARALQRLAA ERAGLPTITP VAAPERLDRT A                291
//

If you have problems or comments...

PBIL Back to PBIL home page